Iright
BRAND / VENDOR: Proteintech

Proteintech, 87277-1-RR, HTR2B Recombinant monoclonal antibody

CATALOG NUMBER: 87277-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The HTR2B (87277-1-RR) by Proteintech is a Recombinant antibody targeting HTR2B in WB, ELISA applications with reactivity to human samples 87277-1-RR targets HTR2B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HT-29 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information The serotonin (5-HT) gene has been implicated in the development of personality traits or temperament predisposition. HTR2B(serotonin receptor 2B) has been shown that 3,4-methylene-dioxymethamphetamine, commonly referred to as the drug ecstasy, selectively binds and activates 5-HT2B receptors to induce serotonin release in mouse raphe nuclei, which leads to dopamine release in the nucleus accumbens and ventral tegmentum (PMID:23774082). Moreover, One of the most reliable predictive markers of UM (Uveal melanoma) at risk of evolving toward the formation of liver lesions is an abnormally elevated level of expression of the transcript encoding the HTR2B (PMID:31002821). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24007 Product name: Recombinant human HTR2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-56 aa of BC063123 Sequence: MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW Predict reactive species Full Name: 5-hydroxytryptamine (serotonin) receptor 2B Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC063123 Gene Symbol: HTR2B Gene ID (NCBI): 3357 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41595 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924