Iright
BRAND / VENDOR: Proteintech

Proteintech, 87306-1-RR, LTBR Recombinant monoclonal antibody

CATALOG NUMBER: 87306-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The LTBR (87306-1-RR) by Proteintech is a Recombinant antibody targeting LTBR in WB, ELISA applications with reactivity to mouse, rat samples 87306-1-RR targets LTBR in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, mouse stomach tissue, rat stomach tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6278 Product name: Recombinant mouse LTBR/TNFRSF3 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 31-223 aa of NM_010736 Sequence: QLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLL Predict reactive species Full Name: lymphotoxin B receptor Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_010736 Gene Symbol: Ltbr Gene ID (NCBI): 17000 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P50284 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924