Iright
BRAND / VENDOR: Proteintech

Proteintech, 87332-1-RR, TLE1 Recombinant monoclonal antibody

CATALOG NUMBER: 87332-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TLE1 (87332-1-RR) by Proteintech is a Recombinant antibody targeting TLE1 in WB, ELISA applications with reactivity to human, mouse samples 87332-1-RR targets TLE1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, mouse lung tissue, A549 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information TLE1 (Transducin-like enhancer protein 1) is a transcriptional corepressor and binds to a number of transcription factors. It can inhibit NF-kappa-B-regulated gene expression and the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (PMID: 10660609). TLE1 is highly expressed in postnatal brain (PMID: 29758293; 27852056). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17299 Product name: Recombinant human TLE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-377 aa of BC010100 Sequence: KDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRTPLAVPGPYPAPFGMVPH Predict reactive species Full Name: transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) Calculated Molecular Weight: 770 aa, 83 kDa Observed Molecular Weight: 80-95 kDa GenBank Accession Number: BC010100 Gene Symbol: TLE1 Gene ID (NCBI): 7088 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04724 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924