Iright
BRAND / VENDOR: Proteintech

Proteintech, 87348-2-RR, IL-18 Recombinant monoclonal antibody

CATALOG NUMBER: 87348-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IL-18 (87348-2-RR) by Proteintech is a Recombinant antibody targeting IL-18 in WB, IP, ELISA applications with reactivity to mouse, rat samples 87348-2-RR targets IL-18 in WB, IP, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat spleen tissue Positive IP detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information IL-18 is a proinflammatory cytokine involved in the development of Th1 cells and in immune response. It can stimulate the NK cells and certain T cells to release IFN gamma, which plays an important role in activating the macrophages or other cells. IL-18 has been demonstrated to have the potential to enhance Fas ligand-mediated cytotoxicity, which is increased in PE and regulates placental apoptosis. IL-18 is synthesized as a 22 kDa precursor and then cleaved into a biologically active 18 kDa form. This antibody recognizes both the pre-IL18 and mature IL18 theoretically. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4455 Product name: recombinant mouse IL-18 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-192 aa of NM_008360.1 Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS Predict reactive species Full Name: interleukin 18 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: NM_008360.1 Gene Symbol: Il18 Gene ID (NCBI): 16173 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P70380 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924