Iright
BRAND / VENDOR: Proteintech

Proteintech, 87374-1-RR, VHL Recombinant monoclonal antibody

CATALOG NUMBER: 87374-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The VHL (87374-1-RR) by Proteintech is a Recombinant antibody targeting VHL in WB, ELISA applications with reactivity to human samples 87374-1-RR targets VHL in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Daudi cells, Raji cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information VHL (von Hippel-Lindau tumor suppressor) gene was identified as the tumor suppressor gene whose germ line mutations are associated with the inherited von Hippel-Lindau cancer syndrome (PMID: 8603073, 10722748). VHL patients develop a wide variety of tumors including retinal angioma, central nervous system hemangioblastoma, pheochromocytoma, and renal clear cell carcinoma (PMID: 10722748). VHL localizes predominantly to the cytoplasmic compartment but engages in a dynamic nuclear-cytoplasmic shuttle (PMID: 8700833, 9891082, 12101228). VHL has isoforms with the molecular mass of 18-24 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6405 Product name: Recombinant human VHL protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-213 aa of NM_000551.4 Sequence: MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD Predict reactive species Full Name: von Hippel-Lindau tumor suppressor Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 18-24 kDa GenBank Accession Number: NM_000551.4 Gene Symbol: VHL Gene ID (NCBI): 7428 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P40337 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924