Iright
BRAND / VENDOR: Proteintech

Proteintech, 87379-1-RR, IL9R Recombinant monoclonal antibody

CATALOG NUMBER: 87379-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IL9R (87379-1-RR) by Proteintech is a Recombinant antibody targeting IL9R in WB, ELISA applications with reactivity to human, rat samples 87379-1-RR targets IL9R in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: MJ cells, PC-3 cells, HEK-293T cells, A549 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Interleukin-9 (IL-9) is a cytokine produced by various cell types including TH2, TH9, TH17, regulatory T (Treg) cells, mast cells, type 2 innate lymphoid cells (ILC2), and CD8+ T cells. IL-9 activates the phosphorylation of Janus kinase 1 (JAK1) and JAK3 by binding to its receptor, IL-9R, thus initiating downstream transcriptional signaling and exerting its biological functions. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2902 Product name: recombinant human IL9R protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 40-270 aa of NM_002186.2 Sequence: VSVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP Predict reactive species Full Name: interleukin 9 receptor Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: NM_002186.2 Gene Symbol: IL9R Gene ID (NCBI): 3581 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q01113-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924