Proteintech, 87402-1-RR, Tnfrsf14 Recombinant monoclonal antibody

Size: 20ul / 100ul The Tnfrsf14 (87402-1-RR) by Proteintech is a Recombinant antibody targeting Tnfrsf14 in WB, ELISA applications with reactivity to mouse samples 87402-1-RR targets Tnfrsf14 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse thymus tissue, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The mammalian tumor necrosis factor receptor (TNFR) family consists of 10 cell-surface proteins that regulate development and homeostasis of the immune system. Member 14 of TNFR (TNFRSF14, also named as TR2, ATAR, HVEA, HVEM, LIGHTR) was also identified as a mediator of herpesvirus entry into mammalian cells. The cytoplasmic region of TNFRSF14 bound to several members of the TNFR-associated factor (TRAF) family, namely TRAF1, TRAF2, TRAF3, and TRAF5. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3145 Product name: Recombinant mouse Tnfrsf14 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 39-207 aa of NM_178931.2 Sequence: QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: NM_178931.2 Gene Symbol: Tnfrsf14 Gene ID (NCBI): 230979 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q80WM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.