Iright
BRAND / VENDOR: Proteintech

Proteintech, 87405-1-RR, PPM1E Recombinant monoclonal antibody

CATALOG NUMBER: 87405-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PPM1E (87405-1-RR) by Proteintech is a Recombinant antibody targeting PPM1E in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 87405-1-RR targets PPM1E in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue, fetal human brain tissue Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Background Information Ca2+/calmodulin-dependent protein kinase phosphatase (CaMKP-N),also known as PPM1E, is an AMPKα phosphatase,which is up-regulated in human gastric cancer tissues (PMID: 28423719). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18903 Product name: Recombinant human PPM1E protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 501-754 aa of BC136290 Sequence: EESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKANLINELMMEKKSVQSSLPEWSGAGEFPTAFNLGSTGEQIYRMQSLSPVCSGLENEQFKSPGNRVSRLSHLRHHYSKKWHRFRFNPKFYSFLSAQEPSHKIGTSLSSLTGSGKRNRIRSSLPWRQNSWKGYSENMRKLRKTHDIPCPDLPWSY Predict reactive species Full Name: protein phosphatase 1E (PP2C domain containing) Calculated Molecular Weight: 764 aa, 85 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: BC136290 Gene Symbol: PPM1E Gene ID (NCBI): 22843 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WY54 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924