Proteintech, 87415-1-RR, ANKFY1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ANKFY1 (87415-1-RR) by Proteintech is a Recombinant antibody targeting ANKFY1 in WB, ELISA applications with reactivity to human samples 87415-1-RR targets ANKFY1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, 5637 cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ANKFY1 also named as ANKHZN or Ankyrin repeats hooked to a zinc finger motif is a 1169 amino acid protein, which is a cytoplasm protein on embryonic stem cells. ANKFY1 protein is ubiquitously expressed in a spatiotemporal specific manner and is located on endosomes. ANKFY1 is expressed at various levels in human tissues and also present in both membrane and soluble fractions obtained on subcellular fractionation. ANKFY1 is a single copy gene consisting of predicted 25 exons in the human genome, and has been mapped to human chromosome 17p13. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19267 Product name: Recombinant human ANKFY1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 817-1170 aa of BC152991 Sequence: GVIIQLLVSHPDIHLNVRDRQGLTPFACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSRVQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLENGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTARFGVTTRKHHCRHCGRLLCHKCSTKEIPIIKFDLNKPVRVCNICFDVLTLGGVS Predict reactive species Full Name: ankyrin repeat and FYVE domain containing 1 Calculated Molecular Weight: 1169 aa, 129 kDa Observed Molecular Weight: 132 kDa GenBank Accession Number: BC152991 Gene Symbol: ANKFY1 Gene ID (NCBI): 51479 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9P2R3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.