Proteintech, 87438-1-RR, SRp20 Recombinant monoclonal antibody

Size: 20ul / 100ul The SRp20 (87438-1-RR) by Proteintech is a Recombinant antibody targeting SRp20 in WB, ELISA applications with reactivity to human, mouse, rat samples 87438-1-RR targets SRp20 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, RAW 264.7 cells, NIH/3T3 cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SFRS3, also named as SRSF3 and SRP20, belongs to the splicing factor SR family. It may be involved in RNA processing in relation with cellular proliferation and/or maturation. SFRS3 is one of the cognate factors. It is a proto-oncogene critical for cell proliferation and tumor induction and maintenance. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1341 Product name: Recombinant human SRp20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC000914 Sequence: MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK Predict reactive species Full Name: splicing factor, arginine/serine-rich 3 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20-24 kDa GenBank Accession Number: BC000914 Gene Symbol: SRSF3 Gene ID (NCBI): 6428 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P84103 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.