Proteintech, 87444-1-RR, ANKRD2 Recombinant monoclonal antibody

Size: 20ul / 100ul The ANKRD2 (87444-1-RR) by Proteintech is a Recombinant antibody targeting ANKRD2 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 87444-1-RR targets ANKRD2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue, pig skeletal muscle tissue, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ANKRD2 belongs to the conserved muscle ankyrin repeat protein (MARP) family. Expression of MARPs is induced in response to physiologic stress, injury, and hypertrophy. Together with Ankrd1/CARP and DARP, ANKRD2 are members of the MARP mechanosensing proteins that form a complex with titin (N2A)/calpain 3 protease/myopalladin. Ankrd2 is thought to have dual, structural and signaling roles, and could link the elastic I-band region as a stress sensor for transcriptional control in the nucleus. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2389 Product name: Recombinant human ANKRD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC020817 Sequence: EAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKEGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ Predict reactive species Full Name: ankyrin repeat domain 2 (stretch responsive muscle) Calculated Molecular Weight: 37 aa, 2 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC020817 Gene Symbol: ANKRD2 Gene ID (NCBI): 26287 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9GZV1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.