Iright
BRAND / VENDOR: Proteintech

Proteintech, 87480-1-RR, LY6K Recombinant monoclonal antibody

CATALOG NUMBER: 87480-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The LY6K (87480-1-RR) by Proteintech is a Recombinant antibody targeting LY6K in WB, ELISA applications with reactivity to human samples 87480-1-RR targets LY6K in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human testis tissue, 143B cells, DU145 cells, SiHa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information The LY6K (Lymphocyte antigen 6K) protein belongs to the LY6/uPAR superfamily and is a class of small glycoproteins that are anchored to the outer side of the cell membrane via glycosylphosphatidylinositol (GPI). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5676 Product name: Recombinant human LY6K protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 18-138 aa of NM_017527.3 Sequence: DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG Predict reactive species Full Name: lymphocyte antigen 6 complex, locus K Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18-26 kDa GenBank Accession Number: NM_017527.3 Gene Symbol: LY6K Gene ID (NCBI): 54742 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q17RY6-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924