Iright
BRAND / VENDOR: Proteintech

Proteintech, 87526-1-RR, STBD1 Recombinant monoclonal antibody

CATALOG NUMBER: 87526-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The STBD1 (87526-1-RR) by Proteintech is a Recombinant antibody targeting STBD1 in WB, ELISA applications with reactivity to human samples 87526-1-RR targets STBD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, A549 cells, Caki-1 cells, HuH-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information STBD1 may have the capability to bind to carbohydrates. It functions as a glycogen receptor that tethers glycogen to autophagic membranes for delivery and breakdown in lysosomes. STBD1 appears molecular mass of 35-38 kDa band in mouse/rat tissues and 38-43 kDa in human tissue. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2481 Product name: Recombinant human STBD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-358 aa of BC022301 Sequence: GPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH Predict reactive species Full Name: starch binding domain 1 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 35-43 kDa GenBank Accession Number: BC022301 Gene Symbol: STBD1 Gene ID (NCBI): 8987 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95210 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924