Proteintech, 87527-1-RR, COPE Recombinant monoclonal antibody

Size: 20ul / 100ul The COPE (87527-1-RR) by Proteintech is a Recombinant antibody targeting COPE in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 87527-1-RR targets COPE in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, PC-3 cells, A375 cells, NIH/3T3 cells, PC-12 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information COPE (Coatomer Protein Complex Subunit Epsilon) is the ε subunit of the COPI complex, a cytoplasmic protein complex composed of seven subunits. It mediates vesicle transport between the Golgi apparatus and the endoplasmic reticulum by binding a double lysine motif, and is crucial for retrograde protein transport (from the Golgi apparatus to the endoplasmic reticulum). (PMID: 10469566; 24497546; 20674546) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2024 Product name: Recombinant human COPE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC017285 Sequence: MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA Predict reactive species Full Name: coatomer protein complex, subunit epsilon Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 32-34 kDa GenBank Accession Number: BC017285 Gene Symbol: COPE Gene ID (NCBI): 11316 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14579 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.