Iright
BRAND / VENDOR: Proteintech

Proteintech, 87536-1-RR, Beclin 1 Recombinant monoclonal antibody

CATALOG NUMBER: 87536-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Beclin 1 (87536-1-RR) by Proteintech is a Recombinant antibody targeting Beclin 1 in WB, ELISA applications with reactivity to human, mouse, rat samples 87536-1-RR targets Beclin 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, Raji cells, HEK-293 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Beclin 1, also known as ATG6 or VPS30, interacts with various cofactors (e.g. Ambra1, Barkor (Atg14), Rubicon, or UVRAG) to regulate the lipid kinase Vps34 and promote the formation of the BECLIN1-Vps34-Vps15 complex, hence inducing autophagy. Its function (via the BH3 domain) is inhibited by Bcl-2 or Bcl-XL. Beclin 1 (BECN1) is a crucial molecule in the control of the autophagic activity, and its activity is regulated by multiple mechanisms, including the post-translational modification, protein-protein interaction, and subcellular localization. It plays a role in crosstalk between apoptosis and autophagy. It has been reported that Beclin 1 can be cleaved into fragments of 50, 37 and 35 kDa during apoptosis. It is involved in many disorders, including neurodegeneration and cancer (tumorigenesis). Beclin 1 is a mammalian tumor suppressor, and its gene is monoallelically deleted in 75% of ovarian, 50% of breast, and 40% of prostate cancers. Decreased expression of Beclin 1 has also been observed in human brain and lung tumors. The level of Beclin 1 was decreased in the affected brain regions of patients with Alzheimer's disease early in the disease process. Recent studies have also shown that gain and loss of Beclin 1 function affects the death of heart cells. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1843 Product name: Recombinant human Beclin 1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 141-450 aa of BC010276 Sequence: TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK Predict reactive species Full Name: beclin 1, autophagy related Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC010276 Gene Symbol: Beclin 1 Gene ID (NCBI): 8678 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14457 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924