Iright
BRAND / VENDOR: Proteintech

Proteintech, 87554-2-RR, P2RX7 Recombinant monoclonal antibody

CATALOG NUMBER: 87554-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The P2RX7 (87554-2-RR) by Proteintech is a Recombinant antibody targeting P2RX7 in WB, ELISA applications with reactivity to mouse samples 87554-2-RR targets P2RX7 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Neuro-2a cells, mouse spinal cord tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs) (PMID: 21724990). P2RX7 functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. P2RX7 is highly expressed by cells of the haemopoietic lineage and can mediate cell death, killing of infectious organisms, and regulation of the inflammatory response (PMID: 22102807). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg7530 Product name: Recombinant mouse P2X7R protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 47-334 aa of NM_011027.3 Sequence: SDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQGNSFFVMTNYVKSEGQVQTLCPEYPRRGAQCSSDRRCKKGWMDPQSKGIQTGRCVPYDKTRKTCEVSAWCPTEEEKEAPRPALLRSAENFTVLIKNNIHFPGHNYTTRNILPTMNGSCTFHKTWDPQCSIFRLGDIFQEAGENFTEVAVQGGIMGIEIYWDCNLDSWSHHCRPRYSFRRLDDKNTDESFVPGYNFRYAKYYKENNVEKRTLIKAFGIRFDILVFGTGGKFDIIQLV Predict reactive species Full Name: purinergic receptor P2X, ligand-gated ion channel, 7 Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: NM_011027.3 Gene Symbol: P2rx7 Gene ID (NCBI): 18439 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Z1M0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924