Proteintech, 87557-1-RR, RUVBL2 Recombinant monoclonal antibody

Size: 20ul / 100ul The RUVBL2 (87557-1-RR) by Proteintech is a Recombinant antibody targeting RUVBL2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 87557-1-RR targets RUVBL2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Daudi cells, HeLa cells, A549 cells, A431 cells, K-562 cells, NIH/3T3 cells, C2C12 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0253 Product name: Recombinant human RUVBL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-463 aa of BC000428 Sequence: SQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS Predict reactive species Full Name: RuvB-like 2 (E. coli) Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC000428 Gene Symbol: RUVBL2 Gene ID (NCBI): 10856 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y230 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.