Proteintech, 87593-1-RR, CD59b Recombinant monoclonal antibody

Size: 20ul / 100ul The CD59b (87593-1-RR) by Proteintech is a Recombinant antibody targeting CD59b in WB, ELISA applications with reactivity to mouse samples 87593-1-RR targets CD59b in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CD59, also named as MIC11, MIN1, MIN2, MIN3, MSK21, MIRL, MACIF, HRF20 and 1F5 antigen, is a cell surface molecule glycoprotein with MW 18-25 kDa. It acts as a determinant of proximal-distal cell identity. CD59 acts by binding to the C8 and/or C9 complements of the assembling membrane attack complex (MAC), thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. It is involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase. CD59b is a GPI-anchored protein that is functionally active as a membrane attack complex inhibitor, which is expressed selectively in the mouse testis (PMID: 10946279; 11471050). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg7565 Product name: Recombinant mouse CD59b protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-104 aa of NM_181858.1 Sequence: LKCYNCLDPVSSCKINTTCSPNLDSCLYAVAGRQVYQQCWKLSDCNSNYIMSRLDVAGIQSKCCQWDLCNKNLDGLEEPNN Predict reactive species Full Name: CD59b antigen Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: NM_181858.1 Gene Symbol: Cd59b Gene ID (NCBI): 333883 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P58019 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.