Iright
BRAND / VENDOR: Proteintech

Proteintech, 87642-1-RR, RAB3A Recombinant monoclonal antibody

CATALOG NUMBER: 87642-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RAB3A (87642-1-RR) by Proteintech is a Recombinant antibody targeting RAB3A in WB, ELISA applications with reactivity to human, mouse, rat samples 87642-1-RR targets RAB3A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, rat cerebellum tissue, mouse brain tissue, rat brain tissue, fetal human brain Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Rab3A is a small G-protein of the Rab family, that is implicated in vesicle fusion and regulated secretion, particularly in neurotransmitter release. Rab3 subfamily small G proteins (Rab3A, Rab3B, Rab3C, and Rab3D) control the regulated exocytosis in neuronal/secretory cells. Rab3A is the most abundant Rab GTPase in brain, where it is associated with synaptic vesicles. Rab3A is believed to modulate secretion efficiency by stimulating vesicle recruitment to sites of exocytosis and/ or by recruiting regulatory molecules to the docking/ fusion machinery. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5438 Product name: Recombinant human RAB3A protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-220 aa of NM_002866.4 Sequence: MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC Predict reactive species Full Name: RAB3A, member RAS oncogene family Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: NM_002866.4 Gene Symbol: RAB3A Gene ID (NCBI): 5864 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20336 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924