Proteintech, 98012-1-RR, Anti-Human CEACAM5/8 (CD66b/e) Rabbit Recombinant Antibody

Size: 100ug The CEACAM5/8 (CD66b/e) (98012-1-RR) by Proteintech is a Recombinant antibody targeting CEACAM5/8 (CD66b/e) in FC applications with reactivity to human samples 98012-1-RR targets CEACAM5/8 (CD66b/e) in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) belong to the immunoglobulin superfamily of cell adhesion molecules. CEACAMs play major roles in cell-cell and cell-ECM adhesion and have been implicated in controlling cell proliferation, angiogenesis, and tissue remodeling (PMID: 23021083). Carcinoembryonic antigen (CEA), also known as CEACAM5 or CD66e mainly serves as a cell adhesion molecule mediating intercellular contact by both homophilic and heterophilic binding (PMID: 21731662). CEACAM8, also known as CD66b, CGM6 or NCA-95, is a glycosylphosphatidylinositol (GPI)-linked glycoprotein expressed on granulocytes and is involved in regulating adhesion and activation of eosinophils (PMID: 8104998; 18056392; 18056392). This antibody is raised against 35-319 aa of human CEACAM8/CD66b and can cross-react with CEACAM5/CD66e. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg32133 Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 35-319 aa of BC026263 Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS Predict reactive species Full Name: CEACAM5/8 (CD66b/e) RRID: AB_3672154 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P31997 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.