Iright
BRAND / VENDOR: Proteintech

Proteintech, 98047-1-RR, Anti-Mouse CXCL1 Rabbit Recombinant Antibody

CATALOG NUMBER: 98047-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CXCL1 (98047-1-RR) by Proteintech is a Recombinant antibody targeting CXCL1 in FC (Intra) applications with reactivity to mouse samples 98047-1-RR targets CXCL1 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: LPS and Brefeldin A treated mouse splenocytes Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in 100 μl suspension Background Information CXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0303 Product name: Recombinant mouse Cxcl1 protein (N-6*HIS) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 25-96 aa of NM_008176 Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK Predict reactive species Full Name: chemokine (C-X-C motif) ligand 1 Calculated Molecular Weight: 10kd GenBank Accession Number: NM_008176 Gene Symbol: Cxcl1 Gene ID (NCBI): 14825 RRID: AB_3672194 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P12850-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924