Proteintech, 98131-4-RR, Anti-Human CD47 Rabbit Recombinant Antibody

Size: 100ug The CD47 (98131-4-RR) by Proteintech is a Recombinant antibody targeting CD47 in FC applications with reactivity to human samples 98131-4-RR targets CD47 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood lymphocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1767 Product name: Recombinant Human CD47 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-139 aa of NM_001777.4 Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP Predict reactive species Full Name: CD47 molecule Calculated Molecular Weight: 35kDa GenBank Accession Number: NM_001777.4 Gene Symbol: CD47 Gene ID (NCBI): 961 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q08722-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.