Iright
BRAND / VENDOR: Proteintech

Proteintech, 98233-1-RR, Anti-Mouse CXCR4/CD184 Rabbit Recombinant Antibody

CATALOG NUMBER: 98233-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CXCR4/CD184 (98233-1-RR) by Proteintech is a Recombinant antibody targeting CXCR4/CD184 in FC applications with reactivity to mouse samples 98233-1-RR targets CXCR4/CD184 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse thymocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information C-X-C chemokine receptor type 4 (CXCR4, also known as CD184) is a widely expressed G protein-coupled seven-transmembrane receptor. CXCL12/SDF-1 is the biological ligand for CXCR4. The binding of CXCL12 to CXCR4 induces intracellular signaling through several divergent pathways initiating signals related to chemotaxis, cell survival and/or proliferation, increase in intracellular calcium, and gene transcription (PMID: 20484021). CXCR4 also functions as a coreceptor for HIV-1 entry (PMID: 9427609). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2231 Product name: Recombinant Mouse CXCR4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-40 aa of NM_009911.3 Sequence: MEPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNR Predict reactive species Full Name: chemokine (C-X-C motif) receptor 4 Calculated Molecular Weight: 40kDa GenBank Accession Number: NM_009911.3 Gene Symbol: Cxcr4 Gene ID (NCBI): 12767 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P70658 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924