Iright
BRAND / VENDOR: Proteintech

Proteintech, 98280-1-RR, Anti-Human CCL22/MDC Rabbit Recombinant Antibody

CATALOG NUMBER: 98280-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CCL22/MDC (98280-1-RR) by Proteintech is a Recombinant antibody targeting CCL22/MDC in FC (Intra) applications with reactivity to human samples 98280-1-RR targets CCL22/MDC in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: human monocyte-derived mature dendritic cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information The C-C motif chemokine ligand 22 (CCL22), also known as MDC, belongs to the group of chemokines, that are both constitutively expressed under homeostatic conditions and inducible upon inflammation. CCL22 is a secreted protein that exerts chemotactic activity for monocytes, dendritic cells, natural killer cells, and for chronically activated T lymphocytes. CCL22 is induced by LPS, IL-4, and IL-13 and in T cells by TCR stimulation. Accumulating studies indicate that CCL22 recruits regulatory T (T-reg) cells into tumor tissues and is expressed in many human tumors. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1974 Product name: Recombinant Human CCL22 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 25-93 aa of BC027952 Sequence: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ Predict reactive species Full Name: chemokine (C-C motif) ligand 22 Calculated Molecular Weight: 93 aa, 11 kDa GenBank Accession Number: BC027952 Gene Symbol: CCL22/MDC Gene ID (NCBI): 6367 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O00626 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924