Proteintech, 98303-5-RR, Anti-Human EPCAM/CD326 Rabbit Recombinant Antibody

Size: 100ug The EPCAM/CD326 (98303-5-RR) by Proteintech is a Recombinant antibody targeting EPCAM/CD326 in FC applications with reactivity to human samples 98303-5-RR targets EPCAM/CD326 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: HT-29 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1370 Product name: Recombinant Human EpCAM/CD326 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-265 aa of NM_002354.3 Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK Predict reactive species Full Name: epithelial cell adhesion molecule Calculated Molecular Weight: 35 kDa GenBank Accession Number: NM_002354.3 Gene Symbol: EPCAM Gene ID (NCBI): 4072 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P16422 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.