Proteintech, 98334-2-RR, Anti-Mouse CSF1R/CD115 Rabbit Recombinant Antibody

Size: 100ug The CSF1R/CD115 (98334-2-RR) by Proteintech is a Recombinant antibody targeting CSF1R/CD115 in FC applications with reactivity to mouse samples 98334-2-RR targets CSF1R/CD115 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse peritoneal macrophages Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The CSF-1 receptor (CSF1R), also called CD115, is activated by the homodimeric growth factors colony-stimulating factor-1 (CSF-1) and interleukin-34 (IL-34). It plays important roles in development and in innate immunity by regulating the development of most tissue macrophages and osteoclasts, of Langerhans cells of the skin, of Paneth cells of the small intestine, and of brain microglia. It also regulates the differentiation of neural progenitor cells and controls functions of oocytes and trophoblastic cells in the female reproductive tract. Owing to this broad tissue expression pattern, it plays a central role in neoplastic, inflammatory, and neurological diseases. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1816 Product name: Recombinant Mouse CSF1R protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-511 aa of NM_001037859.2 Sequence: APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES Predict reactive species Full Name: colony stimulating factor 1 receptor Calculated Molecular Weight: 109 kDa GenBank Accession Number: NM_001037859.2 Gene Symbol: CSF1R/CD115 Gene ID (NCBI): 12978 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09581 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.