Proteintech, 98365-2-RR, Anti-Human NCR3/NKp30 Rabbit Recombinant Antibody

Size: 100ug The NCR3/NKp30 (98365-2-RR) by Proteintech is a Recombinant antibody targeting NCR3/NKp30 in FC applications with reactivity to human samples 98365-2-RR targets NCR3/NKp30 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information NKp30 (CD337) (NCR3) is a 30-kDa type I transmembrane protein characterized by a single V-type immunoglobulin (Ig) extracellular domain. NKp30 expression is mostly restricted to NK cells although recent studies found this NCR to be present on the surface of additional immune cells, including γδ T cells and Innate Lymphoid Cells (ILCs). NKp30 is involved in NK cell-mediated killing of various tumor cell lines, virus-infected cells and also of autologous dendritic cells (DCs) during the so-called "editing" process. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg31663 Product name: Recombinant Human NCR3 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 19-135 aa of BC052582 Sequence: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG Predict reactive species Full Name: natural cytotoxicity triggering receptor 3 Calculated Molecular Weight: 201 aa, 22 kDa GenBank Accession Number: BC052582 Gene Symbol: NCR3 Gene ID (NCBI): 259197 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14931 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.