Proteintech, 98392-1-RR, Anti-Mouse IL-23 p19 Rabbit Recombinant Antibody

Size: 100ug The IL-23 p19 (98392-1-RR) by Proteintech is a Recombinant antibody targeting IL-23 p19 in FC (Intra) applications with reactivity to mouse samples 98392-1-RR targets IL-23 p19 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information IL-12 and IL-23 are heterodimeric cytokines that share a common p40 subunit (PMID: 11114383). IL-12 is composed of the IL-12 p40 subunit linked to the IL-12 p35 subunit, and the heterodimer signals through the IL-12 receptor (IL-12R), which comprises the IL-12Rβ1 and IL-12Rβ2 subunits. IL-23 is composed of the IL-23 p19 subunit and the IL-12 p40 (IL-12/23p40) subunit, which signals through IL-23R and IL-12Rβ1 (PMID: 11114383; 26121196 ). IL-12/IL-23 p40 also exists as a monomer and as a homodimer which can act as a potent IL-12 antagonist (PMID: 8958912; 18783467). IL-12/IL-23 p40 is produced by antigen-presenting cells, such as dendritic cells (DCs), monocytes, macrophages, neutrophils and, to a lesser extent, B cells (PMID: 20476918). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1634 Product name: Recombinant Mouse IL-23 p19/IL23A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-196 aa of NM_031252.2 Sequence: VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA Predict reactive species Full Name: interleukin 23, alpha subunit p19 Calculated Molecular Weight: 22 kDa GenBank Accession Number: NM_031252.2 Gene Symbol: Il23a Gene ID (NCBI): 83430 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9EQ14 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.