Proteintech, 98393-2-RR, Anti-Mouse JAM3 Rabbit Recombinant Antibody

Size: 100ug The JAM3 (98393-2-RR) by Proteintech is a Recombinant antibody targeting JAM3 in FC applications with reactivity to mouse samples 98393-2-RR targets JAM3 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Junctional adhesion molecule 3 (JAM3) is a type I transmembrane glycoprotein containing two Ig-like domains, which is expressed in various tissues and plays a crucial role in cell junctions, cell polarity, and motility (PMID: 34292449; 28931565). It has been proposed that JAM3 participates in leukocyte-platelet interactions, as well as angiogenesis and brain development (PMID: 12208882; 23255084). JAM3 may also be a new marker for predicting the prognosis and immune functions of bladder cancer patients (PMID: 38400838). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2661 Product name: Recombinant Mouse JAM-3 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 30-241 aa of NM_023277.4 Sequence: EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLN Predict reactive species Full Name: junction adhesion molecule 3 Calculated Molecular Weight: 35 kDa GenBank Accession Number: NM_023277.4 Gene Symbol: Jam3 Gene ID (NCBI): 83964 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9D8B7 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.