Proteintech, 98414-4-RR, Anti-Human Prion protein PrP/CD230 Rabbit Recombinant Antibody

Size: 100ug The Prion protein PrP/CD230 (98414-4-RR) by Proteintech is a Recombinant antibody targeting Prion protein PrP/CD230 in FC applications with reactivity to human samples 98414-4-RR targets Prion protein PrP/CD230 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The major prion protein (PrP), also known as CD230, is encoded by the prion protein-encoding gene (PRNP). PrP is widely expressed in a variety of tissues and is abundant in the nervous system and participates in neuronal growth and survival. PrP expression is strongly associated with immune infiltrating cells, immunosuppressive cell infiltration and immune checkpoint molecules. PrP is an immune-related prognostic marker that holds promise for predicting outcomes related to colorectal cancer immunotherapy. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3359 Product name: Recombinant Human Prion protein PrP protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-229 aa of BC012844 Sequence: KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRG Predict reactive species Full Name: prion protein GenBank Accession Number: BC012844 Gene Symbol: PrP Gene ID (NCBI): 5621 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04156 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.