Proteintech, 98415-1-RR, Anti-Human CRLF2 Rabbit Recombinant Antibody

Size: 100ug The CRLF2 (98415-1-RR) by Proteintech is a Recombinant antibody targeting CRLF2 in FC applications with reactivity to human samples 98415-1-RR targets CRLF2 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human monocyte-derived mature dendritic cells, CRLF2-transfected CHO cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Cytokine receptor-like factor 2 (CRLF2), also known as the thymic stromal derived lymphopoietin receptor (TSLPR), which in combination with the interleukin 7 receptor a chain (IL-7R) forms the receptor for thymic stromal lymphopoietin. CRLF2 is a type I cytokine receptor. CRLF2 rearrangements occur either as a translocation to the immunoglobulin heavy-chain enhancer region (IGH-CRLF2) or by a deletion of upstream PAR1 that leads to joining of CRLF2 to adjacent P2RY8. CRLF2 is expressed in heart, skeletal muscle, kidney and adult and fetal liver and is primarily expressed in dendrites and monocytes. (PMID: 20807819; 31644323; 33485429) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2626 Product name: Recombinant Human CRLF2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-231 aa of NM_022148.3 Sequence: GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK Predict reactive species Full Name: cytokine receptor-like factor 2 Calculated Molecular Weight: 42 kDa GenBank Accession Number: NM_022148.3 Gene Symbol: CRLF2 Gene ID (NCBI): 64109 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9HC73 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.