Iright
BRAND / VENDOR: Proteintech

Proteintech, 98423-5-RR, Anti-Mouse TNFSF18 Rabbit Recombinant Antibody

CATALOG NUMBER: 98423-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The TNFSF18 (98423-5-RR) by Proteintech is a Recombinant antibody targeting TNFSF18 in FC applications with reactivity to mouse samples 98423-5-RR targets TNFSF18 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TNFSF18 (Tumor Necrosis Factor Superfamily Member 18), also known as GITRL (Glucocorticoid-Induced TNF Receptor Ligand) or AITRL (Activation-Induced T Cell Receptor Ligand), is a cytokine belonging to the tumor necrosis factor (TNF) ligand family. TNFSF18 is broadly expressed in various tissues, including the gallbladder, brain, and other tissues. TNFSF18 is expressed on the surface of antigen-presenting cells (APCs) such as dendritic cells, macrophages, and B cells. It is also found in endothelial cells, which play a role in the interaction between T lymphocytes and endothelial cells. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2850 Product name: Recombinant Mouse TNFSF18 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 47-173 aa of NM_183391.3 Sequence: TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 18 Calculated Molecular Weight: 20 kDa GenBank Accession Number: NM_183391.3 Gene Symbol: Tnfsf18 Gene ID (NCBI): 240873 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q7TS55 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924