Proteintech, 98460-3-RR, Anti-Mouse Csf2rb2 Rabbit Recombinant Antibody

Size: 100ug The Csf2rb2 (98460-3-RR) by Proteintech is a Recombinant antibody targeting Csf2rb2 in FC applications with reactivity to mouse samples 98460-3-RR targets Csf2rb2 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Csf2rb2 (Colony Stimulating Factor 2 Receptor Beta 2), also known as Interleukin-3 receptor class 2 subunit beta, is a gene that encodes a low-affinity beta subunit of the cytokine receptor complex, primarily found in mice. Csf2rb2 is a downstream molecule of Notch signaling in BM cells (PMID: 27188577). Csf2rb2 is a central node in the immune signaling network, enabling cytokines to regulate innate immunity and inflammation (PMID: 34750506). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2873 Product name: Recombinant Mouse Csf2rb2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-440 aa of NM_007781.3 Sequence: HEVTEEEETVPLKTLECYNDYTNRIICSWADTEDAQGLINMTLLYHQLDKIQSVSCELSEKLMWSECPSSHRCVPRRCVIPYTRFSNGDNDYYSFQPDRDLGIQLMVPLAQHVQPPPPKDIHISPSGDHFLLEWSVSLGDSQVSWLSSKDIEFEVAYKRLQDSWEDASSLHTSNFQVNLEPKLFLPNSIYAARVRTRLSAGSSLSGRPSRWSPEVHWDSQPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPAAPEEKCSPVVKEPQASVYTRYRCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYYHIQMEPPILNQTKNRDSYSLHWETQKIPKYIDHTFQVQYKKKSESWKDSKTENLGRVNSMDLPQLEPDTSYCARVRVKPISDYDGIWSEWSNEYTWTTDW Predict reactive species Full Name: colony stimulating factor 2 receptor, beta 2, low-affinity (granulocyte-macrophage) Calculated Molecular Weight: 97 kDa GenBank Accession Number: NM_007781.3 Gene Symbol: Csf2rb2 Gene ID (NCBI): 12984 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26954 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.