Proteintech, 98466-3-RR, Anti-Mouse GITR/TNFRSF18 Rabbit Recombinant Antibody

Size: 100ug The GITR/TNFRSF18 (98466-3-RR) by Proteintech is a Recombinant antibody targeting GITR/TNFRSF18 in FC applications with reactivity to mouse samples 98466-3-RR targets GITR/TNFRSF18 in IF, FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Glucocorticoid-induced TNFR-related protein (GITR), also known as CD357 or TNFRSF18, is a member of the tumor necrosis factor receptor (TNF-R) superfamily. GITR is expressed constitutively at high levels in T regulatory cells (Treg cells) and plays a key role in dominant immunological self-tolerance maintained by CD25+CD4+ regulatory T cells (PMID: 11812990). It is expressed at low levels on resting responder T cells. The expression of GITR on T cells can be upregulated upon activation (PMID: 15770698). GITR is activated by GITR ligand (GITRL) which is mainly expressed on APC. GITR-GITRL interactions could co-stimulate both responder T-cell functions and the suppressive functions of Treg cells (PMID: 16868552). Specification Tested Reactivity: mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3695 Product name: Recombinant Mouse GITR/TNFRSF18 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-153 aa of NM_009400.2 Sequence: QPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGH Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 18 Calculated Molecular Weight: 25kDa GenBank Accession Number: NM_009400.2 Gene Symbol: CD357 Gene ID (NCBI): 21936 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O35714-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.