Proteintech, 98476-3-RR, Anti-Human CCL24/Eotaxin 2 Rabbit Recombinant Antibody

Size: 100ug The CCL24/Eotaxin 2 (98476-3-RR) by Proteintech is a Recombinant antibody targeting CCL24/Eotaxin 2 in FC (Intra) applications with reactivity to human samples 98476-3-RR targets CCL24/Eotaxin 2 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: CHO cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Chemokine CCL24 is the second member of eotaxins, a group of eosinophils' selectively chemoattractants. CCL24 is constitutively expressed in fibroblasts, epithelial cells, macrophages. CCL24 has only one receptor CCR3, which mainly presents on eosinophils and was also found on basophils, monocytes, Th2 lymphocytes, epithelial cells and airway smooth muscles. CCL24 displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0395 Product name: Recombinant Human CCL24 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 27-119 aa of NM_002991 Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC Predict reactive species Full Name: chemokine (C-C motif) ligand 24 Calculated Molecular Weight: 13kd GenBank Accession Number: NM_002991 Gene Symbol: CCL24/Eotaxin 2 Gene ID (NCBI): 6369 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00175 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.