Proteintech, 98480-1-RR, Anti-Mouse CCL8/MCP-2 Rabbit Recombinant Antibody

Size: 100ug The CCL8/MCP-2 (98480-1-RR) by Proteintech is a Recombinant antibody targeting CCL8/MCP-2 in FC (Intra) applications with reactivity to mouse samples 98480-1-RR targets CCL8/MCP-2 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The cys-cys (C-C) motif chemokine ligand 8 (CCL8, also known as MCP2) is implicated in various inflammatory processes. In bone marrow transplantation, circulating CCL8 levels positively correlate with the severity of graft-versus-host disease. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2771 Product name: Recombinant Mouse CCL8/MCP-2 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-97 aa of NM_021443.3 Sequence: GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP Predict reactive species Full Name: chemokine (C-C motif) ligand 8 Calculated Molecular Weight: 11 kDa GenBank Accession Number: NM_021443.3 Gene Symbol: Ccl8 Gene ID (NCBI): 20307 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Z121 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.