Proteintech, 98497-3-RR, Anti-Rat CXCL7/PPBP Rabbit Recombinant Antibody

Size: 100ug The CXCL7/PPBP (98497-3-RR) by Proteintech is a Recombinant antibody targeting CXCL7/PPBP in FC (Intra) applications with reactivity to rat samples 98497-3-RR targets CXCL7/PPBP in FC (Intra) applications and shows reactivity with rat samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PPBP, slso named as NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3405 Product name: recombinant rat CXCL7/Thymus Chemokine-1 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 46-107 aa of NM_153721.1 Sequence: IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI Predict reactive species Full Name: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) Calculated Molecular Weight: 12 kDa GenBank Accession Number: NM_153721.1 Gene Symbol: Ppbp Gene ID (NCBI): 246358 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99ME0 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.