Proteintech, 98502-2-RR, Anti-Mouse CCL1 Rabbit Recombinant Antibody

Size: 100ug The CCL1 (98502-2-RR) by Proteintech is a Recombinant antibody targeting CCL1 in FC (Intra) applications with reactivity to mouse samples 98502-2-RR targets CCL1 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CCL1, also known as I-309 in human or TCA-3 in mice, is a small glycoprotein belonging to the CC chemokine family. It is predominantly expressed by activated T cells, monocytes, and endothelial cells, and primarily acts as a chemoattractant for monocytes and T cells. CCL1 binds to the receptor CCR8, which is expressed on monocytes, neutrophils, and T cells, including within the thymus. This chemokine may perform dual functions: as an inflammatory chemokine during leukocyte migration into inflammatory sites and as a constitutive chemokine during T cell selection in the thymus. Furthermore, CCL1 has been associated with allergic inflammation and the recruitment of Th2 cells, suggesting a role in allergic diseases such as asthma. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3293 Product name: Recombinant Mouse CCL1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-92 aa of NM_011329.3 Sequence: KSMLTVSNSCCLNTLKKELPLKFIQCYRKMGSSCPDPPAVVFRLNKGRESCASTNKTWVQNHLKKVNPC Predict reactive species Full Name: chemokine (C-C motif) ligand 1 Calculated Molecular Weight: 10KD GenBank Accession Number: NM_011329.3 Gene Symbol: Ccl1 Gene ID (NCBI): 20290 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10146-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.