Iright
BRAND / VENDOR: Proteintech

Proteintech, 98557-1-RR, Anti-Human FCRL1 Rabbit Recombinant Antibody

CATALOG NUMBER: 98557-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The FCRL1 (98557-1-RR) by Proteintech is a Recombinant antibody targeting FCRL1 in FC applications with reactivity to human samples 98557-1-RR targets FCRL1 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs, Transfected CHO cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Fc receptor-like protein 1 (FCRL1) is a type I transmembrane glycoprotein that plays a crucial role in regulating B-cell receptor (BCR)-mediated signaling responses (PMID:15479727). It contains intracellular tyrosine-based motifs that can modulate BCR signaling, leading to changes in calcium flux, proliferation, and antibody production (PMID: 37822931). FCRL1 is involved in regulating B-cell development and activation, with its signaling pathways influencing ERK activation through interactions with proteins such as GRB2. This regulation is essential for maintaining B-cell homeostasis and preventing the development of autoreactive B cells (PMID: 34697226). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3713 Product name: Recombinant Human FCRL1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 17-307 aa of BC033690 Sequence: AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNHLTS Predict reactive species Full Name: Fc receptor-like 1 Calculated Molecular Weight: 429 aa, 47 kDa GenBank Accession Number: BC033690 Gene Symbol: FCRL1 Gene ID (NCBI): 115350 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96LA6 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924