Iright
BRAND / VENDOR: Proteintech

Proteintech, 98568-1-RR, Anti-Human DR3 Rabbit Recombinant Antibody

CATALOG NUMBER: 98568-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The DR3 (98568-1-RR) by Proteintech is a Recombinant antibody targeting DR3 in FC applications with reactivity to human, hamster samples 98568-1-RR targets DR3 in FC applications and shows reactivity with human, hamster samples. Tested Applications Positive FC detected in: Transfected CHO-K1 Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information DR3, also named as APO3, DDR3, TNFRSF25, TNFRSF12, WSL, WSL1, LARD, TRAMP and AIR, is a receptor for TNFSF12/APO3L/TWEAK. TNFRSF25 interacts directly with the adapter TRADD. It mediates activation of NF-kappa-B and induces apoptosis. TNFRSF25 may play a role in regulating lymphocyte homeostasis. It is constitutively and highly expressed by CD4(+)FoxP3(+) Tregs. This antibody can recognize all the isoform of TNFRSF25. Specification Tested Reactivity: human, hamster Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1988 Product name: recombinant human TNFRSF25 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 25-199 aa of NM_148965. Sequence: QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 25 Calculated Molecular Weight: 46 kDa GenBank Accession Number: NM_148965. Gene Symbol: DR3 Gene ID (NCBI): 8718 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q93038 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924