Iright
BRAND / VENDOR: Proteintech

Proteintech, 98569-3-RR, Anti-Mouse IL-20RB Rabbit Recombinant Antibody

CATALOG NUMBER: 98569-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IL-20RB (98569-3-RR) by Proteintech is a Recombinant antibody targeting IL-20RB in FC applications with reactivity to human, mouse samples 98569-3-RR targets IL-20RB in FC applications and shows reactivity with human, mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin-20 receptor subunit beta (IL20RB) is a single-pass type I membrane protein of the type II cytokine receptor family. The interleukin-20-receptor I complex (IL-20-RI) is composed of two chains, IL20RA and IL20RB. IL-20-RI is a receptor for IL-19, IL-20 and IL-24. IL20RB can also form a heterodimer with IL22RA1. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3168 Product name: Recombinant Mouse IL-20RB protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-225 aa of NM_001033543.3 Sequence: VSVLPAPQNLSVQSTNMKHLLMWNPVTQPGETVLYCVEYQGEYESLYMSHIWIPSSQCSPTKSLECDVTDDITATVPYNFRVKAMLGSQTSAWSNLEHPFNRNATVLTPPRMEVTEHGLHLVIELEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPTCVEMQGES Predict reactive species Full Name: interleukin 20 receptor beta Calculated Molecular Weight: 34 kDa GenBank Accession Number: NM_001033543.3 Gene Symbol: Il20rb Gene ID (NCBI): 213208 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: E9Q9A6 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924