Proteintech, 98613-3-RR, Anti-Pig IL-4 Rabbit Recombinant Antibody

Size: 100ug The IL-4 (98613-3-RR) by Proteintech is a Recombinant antibody targeting IL-4 in FC (Intra) applications with reactivity to pig samples 98613-3-RR targets IL-4 in FC (Intra) applications and shows reactivity with pig samples. Tested Applications Positive FC (Intra) detected in: Transfected CHO cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IL-4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL-4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL-4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival. Specification Tested Reactivity: pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4866 Product name: Recombinant Pig IL-4 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 25-133 aa of NM_214123.1 Sequence: HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC Predict reactive species Full Name: Interleukin-4 Calculated Molecular Weight: 15 kDa GenBank Accession Number: NM_214123.1 Gene Symbol: IL-4 Gene ID (NCBI): 397225 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04745 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.