Proteintech, 98628-1-RR, Anti-Human CD158Z/KIR3DL3 Rabbit Recombinant Antibody

Size: 100ug The CD158Z/KIR3DL3 (98628-1-RR) by Proteintech is a Recombinant antibody targeting CD158Z/KIR3DL3 in FC applications with reactivity to human samples 98628-1-RR targets CD158Z/KIR3DL3 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: Transfected CHO-K1 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD158z, also known as KIR3DL3, is an inhibitory receptor belonging to the Killer-cell Immunoglobulin-like Receptor (KIR) family. It plays a critical role in the regulation of the human immune system, specifically by modulating the activity of natural killer (NK) cells and certain T cells Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4358 Product name: Recombinant Human KIR3DL3 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-322 aa of / Sequence: QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL Predict reactive species Full Name: killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 3 Calculated Molecular Weight: 45 kDa GenBank Accession Number: / Gene Symbol: KIR3DL3 Gene ID (NCBI): 115653 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N743 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.