Proteintech, 98640-1-RR, Anti-Pig IL-1 beta Rabbit Recombinant Antibody

Size: 100ug The IL-1 beta (98640-1-RR) by Proteintech is a Recombinant antibody targeting IL-1 beta in FC (Intra) applications with reactivity to pig samples 98640-1-RR targets IL-1 beta in FC (Intra) applications and shows reactivity with pig samples. Tested Applications Positive FC (Intra) detected in: Transfected CHO-K1 Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Specification Tested Reactivity: pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4869 Product name: Recombinant Pig IL-1 beta protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 115-267 aa of NM_214055.1 Sequence: ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP Predict reactive species Full Name: Interleukin-1 beta Calculated Molecular Weight: 30 kDa GenBank Accession Number: NM_214055.1 Gene Symbol: IL-1B Gene ID (NCBI): 397122 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26889 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.