Iright
BRAND / VENDOR: Proteintech

Proteintech, 98663-1-RR, Anti-Human Glycophorin B/CD235b Rabbit Recombinant Antibody

CATALOG NUMBER: 98663-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The Glycophorin B/CD235b (98663-1-RR) by Proteintech is a Recombinant antibody targeting Glycophorin B/CD235b in FC applications with reactivity to human samples 98663-1-RR targets Glycophorin B/CD235b in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: Human peripheral blood erythrocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Glycophorin B/CD235b (GYPB) is a single-pass transmembrane sialoglycoprotein expressed on the surface of human red blood cells (RBCs). Glycophorin B/CD235b is primarily known for determining the Ss blood group and playing a role in malaria susceptibility.It is encoded by the GYPB gene and is structurally similar to glycophorin A (GPA), though present at lower abundance. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3516 Product name: recombinant human GYPB protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-59 aa of BC121077 Sequence: LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA Predict reactive species Full Name: glycophorin B (MNS blood group) GenBank Accession Number: BC121077 Gene Symbol: GYPB Gene ID (NCBI): 2994 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P06028 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924