Iright
BRAND / VENDOR: Proteintech

Proteintech, 98684-1-RR, Anti-Human IL-22RA1 Rabbit Recombinant Antibody

CATALOG NUMBER: 98684-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IL-22RA1 (98684-1-RR) by Proteintech is a Recombinant antibody targeting IL-22RA1 in FC applications with reactivity to human samples 98684-1-RR targets IL-22RA1 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: COLO 205 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin-22 (IL-22), a member of the IL-10 family of cytokines, is important for the modulation of tissue responses during inflammation. IL-22 receptor is a heterodimer of the IL-10RB and IL-22RA1. IL-22RA1 belongs to the class II cytokine receptor family. It is expressed in a limited number of tissues including skin, colon, liver, lung, pancreas and kidney. The expression is lack in immune cells such as monocytes, T cells, and NK cells (PMID: 15308104). IL-22RA1 can also form a receptor for IL-20 and IL-24 with IL20RB (PMID: 23793061). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5132 Product name: Recombinant human IL22RA1 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 16-228 aa of BC029273 Sequence: HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWT Predict reactive species Full Name: interleukin 22 receptor, alpha 1 Calculated Molecular Weight: 574 aa, 63 kDa GenBank Accession Number: BC029273 Gene Symbol: IL-22RA1 Gene ID (NCBI): 58985 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N6P7 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924