Proteintech, 98689-3-RR, Anti-Canine CXCL8/IL-8 Rabbit Recombinant Antibody

Size: 100ug The CXCL8/IL-8 (98689-3-RR) by Proteintech is a Recombinant antibody targeting CXCL8/IL-8 in FC (Intra) applications with reactivity to canine samples 98689-3-RR targets CXCL8/IL-8 in FC (Intra) applications and shows reactivity with canine samples. Tested Applications Positive FC (Intra) detected in: Transfected CHO Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin 8 (IL-8), also known as CXCL8, is a CXC chemokine family member. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression. Specification Tested Reactivity: canine Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4552 Product name: Recombinant Canine CXCL8/IL-8 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-101 aa of NM_001003200.1 Sequence: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP Predict reactive species Full Name: Interleukin-8 Calculated Molecular Weight: 11 kDa GenBank Accession Number: NM_001003200.1 Gene Symbol: IL-8 Gene ID (NCBI): 403850 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41324 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.