Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98048, FcZero-rAb™ APC Anti-Human uPAR/CD87 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98048
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The uPAR/CD87 (APC-FcA98048) by Proteintech is a Recombinant antibody targeting uPAR/CD87 in FC applications with reactivity to human samples APC-FcA98048 targets uPAR/CD87 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: PMA treated U-937 cells Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information uPAR, also known as CD87, is a highly glycosylated, GPI-anchored membrane protein. In addition to the membrane-anchored form, uPAR is released from the plasma membrane by cleavage of the GPI anchor and can be found as a soluble form (suPAR). uPAR contains three homologous domains (D1-D3) of which the N-terminal one (D1) represents the uPA-binding domain. After binding to uPAR, uPA cleaves plasminogen, generating the active protease plasmin which is involved in a wide variety of physiologic and pathologic processes. In addition to regulating proteolysis, uPAR has important function in cell adhesion, migration and proliferation. Studies reveal that uPAR expression is elevated during inflammation and tissue remodeling and in many human cancers, in which it frequently indicates poor prognosis. (PMID 20027185; 12461559) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0901 Product name: Recombinant Human uPAR/PLAUR protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-303 aa of NM_002659.4 Sequence: LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYR Predict reactive species Full Name: PLAUR Calculated Molecular Weight: 37 kDa GenBank Accession Number: NM_002659.4 Gene Symbol: uPAR Gene ID (NCBI): 5329 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q03405-1 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924