Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98070, FcZero-rAb™ APC Anti-Human Granzyme B Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98070
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The Granzyme B (APC-FcA98070) by Proteintech is a Recombinant antibody targeting Granzyme B in FC (Intra) applications with reactivity to human samples APC-FcA98070 targets Granzyme B in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in 100 μl suspension Background Information GZMB (Granzyme B) is also named as CGL1, CSPB, CTLA1, GRB and belongs to the Granzyme subfamily. This enzyme is necessary for target cell lysis in cell-mediated immune responses. The cytotoxic lymphocyte protease granzyme B can promote apoptosis through direct processing and activation of members of the caspase family. Granzyme B can also cleave the BH3-only protein, BID, to promote caspase-independent mitochondrial permeabilization (PMID:17283187). Granzyme B induces lamin B degradation in isolated nuclei less efficiently than Granzyme A (PMID:11331782). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0592 Product name: Recombinant Human Granzyme B protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*HIS Domain: 19-247 aa of BC030195 Sequence: GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY Predict reactive species Full Name: granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) Calculated Molecular Weight: 247 aa, 28 kDa GenBank Accession Number: BC030195 Gene Symbol: Granzyme B Gene ID (NCBI): 3002 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10144 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924