Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98113, FcZero-rAb™ APC Anti-Mouse CD30 Ligand/TNFSF8 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98113
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD30 Ligand/TNFSF8 (APC-FcA98113) by Proteintech is a Recombinant antibody targeting CD30 Ligand/TNFSF8 in FC applications with reactivity to mouse samples APC-FcA98113 targets CD30 Ligand/TNFSF8 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Anti-CD3/CD28 treated mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD30 Ligand (CD30L), also named as TNFSF8 or CD153, is a type II transmembrane protein that belongs to the tumor necrosis factor (TNF) superfamily (PMID: 8391931). It is expressed on the surface of activated T cells, B cells, monocytes, macrophages, eosinophils, neutrophils, and mast cells (PMID: 26090498). CD30L interacts with its receptor, CD30, which is a cell surface protein expressed on a small subset of activated T and B lymphocytes, and a variety of lymphoid neoplasms, with the highest expression in classical Hodgkin lymphoma and anaplastic large cell lymphomas (PMID: 28885612). The CD30/CD30L signaling is involved in pleiotropic downstream effects including differentiation, cell survival and death, NFkB activation, and production of cytokines (PMID: 38534788). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0667 Product name: Recombinant Mouse CD30 Ligand/TNFSF8 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 68-239 aa of NM_009403.3 Sequence: QKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 8 Calculated Molecular Weight: 27 kDa GenBank Accession Number: NM_009403.3 Gene Symbol: Tnfsf8 Gene ID (NCBI): 21949 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P32972 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924